ZNF300 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF300 antibody: synthetic peptide directed towards the N terminal of human ZNF300. Synthetic peptide located within the following region: DISNWIYPDEYQADGRQDRKSNLHNSQSCILGTVSFHHKILKGVTRDGSL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	69 kDa
Gene Name	zinc finger protein 300
Database Link	NP_443092 Entrez Gene 91975 Human UniProt ID Q96RE9
Background	The protein encoded byThis gene is a C2H2-type zinc finger DNA binding protein and likely transcriptional regulator.The function ofThis protein is not yet known. Three transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Mar 2010]
Synonyms	DKFZp686B24204
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Bovine: 92%; Horse: 79%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.