BORIS (CTCFL) Rabbit Polyclonal Antibody

CAT#: TA341445

Rabbit Polyclonal Anti-CTCFL Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (2)
Transient overexpression lysate of CCCTC-binding factor (zinc finger protein)-like (CTCFL)
    • 100 ug

CNY 4840.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-CTCFL antibody: synthetic peptide directed towards the N terminal of human CTCFL. Synthetic peptide located within the following region: CREKDHRSPSELEAERTSGAFQDSVLEEEVELVLAPSEESEKYILTLQTV
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 76 kDa
Gene Name CCCTC-binding factor like
Background CCCTC-binding factor (CTCF), an 11-zinc-finger factor involved in gene regulation, utilizes different zinc fingers to bind varying DNA target sites. CTCF forms methylation-sensitive insulators that regulate X-chromosome inactivation.This gene is a paralog of CTCF and appears to be expressed primarily inThe cytoplasm of spermatocytes, unlike CTCF which is expressed primarily inThe nucleus of somatic cells. CTCF andThe protein encoded byThis gene are normally expressed in a mutually exclusive pattern that correlates with resetting of methylation marks during male germ cell differentiation. Multiple alternatively spliced transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Jun 2012]
Synonyms BORIS; CT27; CTCF-T; dJ579F20.2; HMGB1L1
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families Transcription Factors
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...