ZNF641 Rabbit Polyclonal Antibody
CAT#: TA341473
Rabbit Polyclonal Anti-ZNF641 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 3080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ZNF641 antibody: synthetic peptide directed towards the middle region of human ZNF641. Synthetic peptide located within the following region: CGIVVSLRFPIPKLDMLSQLEGGEEQWVPDPQDLEERDILRVTYTGGGSE |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 49 kDa |
Gene Name | zinc finger protein 641 |
Database Link | |
Background | ZNF641 is a transcriptional activatior. It activates transcriptional activities of SRE and AP-1. |
Synonyms | DKFZp667D1012; FLJ31295 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 93%; Bovine: 92%; Mouse: 79% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |