C20orf203 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-FLJ33706 antibody: synthetic peptide directed towards the C terminal of human FLJ33706. Synthetic peptide located within the following region: RMGTVGDFGQALSSLAWTSTCFQDFCLPSLPGKLPAPLISKQQFLSNSSR
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	221 kDa
Gene Name	chromosome 20 open reading frame 203
Database Link	NP_872390 Entrez Gene 284805 Human UniProt ID Q8NBC4
Background	The exact function of FLJ33706 remains unknown.
Synonyms	RP11-503P21.2
Note	Immunogen Sequence Homology: Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.