AKAP5 Rabbit Polyclonal Antibody

CAT#: TA341549

Rabbit Polyclonal Anti-AKAP5 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (2)
Transient overexpression lysate of A kinase (PRKA) anchor protein 5 (AKAP5)
    • 100 ug

CNY 4840.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-AKAP5 antibody: synthetic peptide directed towards the middle region of human AKAP5. Synthetic peptide located within the following region: KQFLISAENEQVGVFANDNGFEDRTSEQYETLLIETASSLVKNAIQLSIE
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 47 kDa
Gene Name A-kinase anchoring protein 5
Background The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which haveThe common function of binding toThe regulatory subunit of protein kinase A (PKA) and confiningThe holoenzyme to discrete locations withinThe cell.This gene encodes a member ofThe AKAP family.The encoded protein binds toThe RII-beta regulatory subunit of PKA, and also to protein kinase C andThe phosphatase calcineurin. It is predominantly expressed in cerebral cortex and may anchorThe PKA protein at postsynaptic densities (PSD) and be involved inThe regulation of postsynaptic events. It is also expressed in T lymphocytes and may function to inhibit interleukin-2 transcription by disrupting calcineurin-dependent dephosphorylation of NFAT. [provided by RefSeq, Jul 2008]
Synonyms AKAP75; AKAP79; H21
Note Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 86%; Horse: 86%; Bovine: 86%; Yeast: 82%; Rat: 79%; Mouse: 79%
Reference Data
Protein Families Druggable Genome
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...