ANXA8L1 Rabbit Polyclonal Antibody

CAT#: TA341647

Rabbit Polyclonal Anti-ANXA8L2 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-ANXA8L2 antibody: synthetic peptide directed towards the middle region of human ANXA8L2. Synthetic peptide located within the following region: VFEEYEKIANKSIEDSIKSETHGSLEEAMLTVVKCTQNLHSYFAERLYYA
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 37 kDa
Gene Name annexin A8-like 1
Background ANXA8L2 is a member ofThe annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins.The protein may function as an anticoagulant that indirectly inhibitsThe thromboplastin-specific complex. Overexpression ofThis gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy ofThis gene is found in close proximity onThe long arm of chromosome 10.This gene encodes a member ofThe annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins.The encoded protein may function as an an anticoagulant that indirectly inhibitsThe thromboplastin-specific complex. Overexpression ofThis gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy ofThis gene is found in close proximity onThe long arm of chromosome 10.
Synonyms ANXA8; bA145E20.2
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Mouse: 93%; Dog: 86%; Zebrafish: 86%; Guinea pig: 86%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...