GJA5 Rabbit Polyclonal Antibody
CNY 5200.00
CNY 300.00
CNY 1430.00
CNY 3080.00
CNY 3080.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-GJA5 antibody: synthetic peptide directed towards the N terminal of human GJA5. Synthetic peptide located within the following region: STPSLVYMGHAMHTVRMQEKRKLREAERAKEVRGSGSYEYPVAEKAELSC |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Concentration | lot specific |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 39 kDa |
| Gene Name | gap junction protein alpha 5 |
| Database Link | |
| Background | This gene is a member ofThe connexin gene family.The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route forThe diffusion of low molecular weight materials from cell to cell. Mutations inThis gene may be associated with atrial fibrillation. Alternatively spliced transcript variants encodingThe same isoform have been described. [provided by RefSeq, Jul 2008] |
| Synonyms | ATFB11; CX40 |
| Note | Immunogen Sequence Homology: Human: 100%; Pig: 93%; Dog: 86%; Rabbit: 82%; Rat: 79%; Horse: 79%; Bovine: 79% |
| Reference Data | |
| Protein Families | Transmembrane |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
