TJP1 Rabbit Polyclonal Antibody
CNY 5250.00
Cited in 1 publication. |
CNY 2900.00
CNY 6650.00
CNY 4840.00
CNY 9998.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-TJP1 antibody: synthetic peptide directed towards the middle region of human TJP1. Synthetic peptide located within the following region: QNHVLKQPAVSHPGHRPDKEPNLTYEPQLPYVEKQASRDLEQPTYRYESS |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 187 kDa |
Gene Name | tight junction protein 1 |
Database Link | |
Background | This gene encodes a protein located on a cytoplasmic membrane surface of intercellular tight junctions.The encoded protein may be involved in signal transduction at cell-cell junctions. Alternative splicing ofThis gene results in multiple transcript variants. [provided by RefSeq, Jul 2014] |
Synonyms | ZO-1 |
Note | Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Dog: 92%; Mouse: 87%; Guinea pig: 86% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Adherens junction, Epithelial cell signaling in Helicobacter pylori infection, Gap junction, Tight junction, Vibrio cholerae infection |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
Promoting effect of the Maillard reaction products produced during the stir-frying process of Hordei Fructus Germinatus on the intestinal absorption of active ingredients in Hordei Fructus Germinatus
,Wu, L;Tan, L;Gong, F;Xia, Y;Chu, R;Yang, H;,
Food Science and Biotechnology
[TJP1]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |