TJP1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TJP1 antibody: synthetic peptide directed towards the middle region of human TJP1. Synthetic peptide located within the following region: QNHVLKQPAVSHPGHRPDKEPNLTYEPQLPYVEKQASRDLEQPTYRYESS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	187 kDa
Gene Name	tight junction protein 1
Database Link	NP_783297 Entrez Gene 7082 Human UniProt ID Q07157
Background	This gene encodes a protein located on a cytoplasmic membrane surface of intercellular tight junctions.The encoded protein may be involved in signal transduction at cell-cell junctions. Alternative splicing ofThis gene results in multiple transcript variants. [provided by RefSeq, Jul 2014]
Synonyms	ZO-1
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Dog: 92%; Mouse: 87%; Guinea pig: 86%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Adherens junction, Epithelial cell signaling in Helicobacter pylori infection, Gap junction, Tight junction, Vibrio cholerae infection

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.