MCM9 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MCM9 antibody: synthetic peptide directed towards the N terminal of human MCM9. Synthetic peptide located within the following region: NSDQVTLVGQVFESYVSEYHKNDILLILKERDEDAHYPVVVNAMTLFETN
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	44 kDa
Gene Name	minichromosome maintenance 9 homologous recombination repair factor
Database Link	NP_694987 Entrez Gene 254394 Human UniProt ID Q9NXL9
Background	The protein encoded byThis gene is a member ofThe mini-chromosome maintenance (MCM) protein family that are essential forThe initiation of eukaryotic genome replication. Binding ofThis protein to chromatin has been shown to be a pre-requisite for recruitingThe MCM2-7 helicase to DNA replication origins.This protein also binds, and is a positive regulator of,The chromatin licensing and DNA replication factor 1, CDT1. [provided by RefSeq, Nov 2010]
Synonyms	C6orf61; dJ329L24.1; dJ329L24.3; MCMDC1; ODG4
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 93%; Guinea pig: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.