Nkx3-2 Rabbit Polyclonal Antibody
CAT#: TA341748
Rabbit Polyclonal Anti-Nkx3-2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 300.00
CNY 1430.00
CNY 2900.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-Bapx1 antibody: synthetic peptide directed towards the N terminal of mouse Bapx1. Synthetic peptide located within the following region: MAVRGSGTLTPFSIQAILNKKEERGGLATPEGRPAPGGTEVAVTAAPAVC |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 37 kDa |
Gene Name | NK3 homeobox 2 |
Database Link | |
Background | Bapx1 acts as a negative regulator of chondrocyte maturation.The constitutive RelA activation mediated by Bapx1 controls chondrocyte viability. |
Synonyms | BAPX1; NKX3.2; NKX3B; SMMD |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Human: 93%; Zebrafish: 85%; Rat: 83%; Horse: 83% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |