Ciita Rabbit Polyclonal Antibody

CAT#: TA341750

Rabbit Polyclonal Anti-Ciita Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Mouse
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-C2TA antibody: synthetic peptide directed towards the C terminal of mouse C2TA. Synthetic peptide located within the following region: MALWESLQQQGEAQLLQAAEEKFTIEPFKAKSPKDVEDLDRLVQTQRLRN
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 119 kDa
Gene Name class II transactivator
Background Essential for transcriptional activity ofThe HLA class II promoter; activation is viaThe proximal promoter. No DNA binding of in vitro translated CIITA was detected. May act in a coactivator-like fashion through protein-protein interactions by contacting factors binding toThe proximal MHC class II promoter, to elements ofThe transcription machinery, or both. Alternatively it may activate HLA class II transcription by modifying proteins that bind toThe MHC class II promoter. Also mediates enhanced MHC class I transcription,The promoter element requirements for CIITA-mediated transcription are distinct from those of constitutive MHC class I transcription, and CIITA can functionally replace TAF1 atThese genes. Exhibits intrinsic GTP-stimulated acetyltransferase activity. Exhibits serine/threonine protein kinase activity: phosphorylatesThe TFIID component TAF7,The RAP74 subunit ofThe general transcription factor TFIIF, histone H2B at 'Ser-37' and other histones.
Synonyms C2TA; CIITAIV; MHC2TA; NLRA
Note Immunogen Sequence Homology: Dog: 100%; Mouse: 100%; Rat: 93%; Human: 79%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...