PIAS2 Rabbit Polyclonal Antibody

CAT#: TA341797

Rabbit Polyclonal Anti-Pias2 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (3)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Transient overexpression lysate of protein inhibitor of activated STAT, 2 (PIAS2), transcript variant beta
    • 100 ug

CNY 4840.00


Transient overexpression lysate of protein inhibitor of activated STAT, 2 (PIAS2), transcript variant alpha
    • 100 ug

CNY 3080.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution WB, IHC
Reactivity Mouse, Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-Pias2 antibody: synthetic peptide directed towards the C terminal of mouse Pias2. Synthetic peptide located within the following region: LSLIPVDPQYCPPMFLDSLTSPLTASSTSVTTTSPHESSTHVSSSSSRSE
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 54 kDa
Gene Name protein inhibitor of activated STAT 2
Background Functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizingThe interaction between UBE2I andThe substrate, and as a SUMO-tethering factor. Plays a crucial role as a transcriptional coregulation in various cellular pathways, includingThe STAT pathway,The p53 pathway andThe steroid hormone signaling pathway.The effects ofThis transcriptional coregulation, transactivation or silencing may vary depending uponThe biological context and PIAS2 isoform studied. However, it seems to be mostly involved in gene silencing. Binds to sumoylated ELK1 and enhances its transcriptional activity by preventing recruitment of HDAC2 by ELK1, thus reversing SUMO-mediated repression of ELK1 transactivation activity. Isoform PIASx-beta, but not isoform PIASx-alpha, promotes MDM2 sumoylation. Isoform PIASx-alpha promotes PARK7 sumoylation. Isoform PIASx-beta promotes NCOA2 sumoylation more efficiently than isoform PIASx-alpha (By similarity). Sumoylates PML at'Lys-65' and 'Lys-160'.
Synonyms ARIP3; DIP; MIZ; MIZ1; PIASX; PIASX-ALPHA; PIASX-BETA; SIZ2; ZMIZ4
Note Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Mouse: 100%; Human: 93%; Bovine: 93%; Rabbit: 93%
Reference Data
Protein Families Stem cell - Pluripotency, Stem cell relevant signaling - JAK/STAT signaling pathway, Transcription Factors
Protein Pathways Jak-STAT signaling pathway, Pathways in cancer, Small cell lung cancer, Ubiquitin mediated proteolysis
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...