CORIN Rabbit Polyclonal Antibody

CAT#: TA341848

Rabbit Polyclonal Anti-CORIN Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4537.00


货期*
2周

规格
    • 100 ug

Product images

推荐一起购买 (3)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human corin, serine peptidase (CORIN), 20 µg
    • 20 ug

CNY 2900.00


Recombinant protein of human corin, serine peptidase (CORIN), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-CORIN antibody: synthetic peptide directed towards the C terminal of human CORIN. Synthetic peptide located within the following region: HPRYSRAVVDYDISIVELSEDISETGYVRPVCLPNPEQWLEPDTYCYITG
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 74 kDa
Gene Name corin, serine peptidase
Background This gene encodes a member ofThe type II transmembrane serine protease class ofThe trypsin superfamily. Members ofThis family are composed of multiple structurally distinct domains.The encoded protein converts pro-atrial natriuretic peptide to biologically active atrial natriuretic peptide, a cardiac hormone that regulates blood volume and pressure.This protein may also function as a pro-brain-type natriuretic peptide convertase. Multiple alternatively spliced transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Jun 2013]
Synonyms ATC2; CRN; Lrp4; PEE5; TMPRSS10
Note Immunogen Sequence Homology: Human: 100%; Rat: 92%; Pig: 86%; Horse: 86%; Rabbit: 86%; Mouse: 79%; Bovine: 79%; Guinea pig: 79%
Reference Data
Protein Families Druggable Genome, Protease, Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...