RER1 Rabbit Polyclonal Antibody

CAT#: TA341877

Rabbit Polyclonal Anti-RER1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (4)
Transient overexpression lysate of RER1 retention in endoplasmic reticulum 1 homolog (S. cerevisiae) (RER1)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human RER1 retention in endoplasmic reticulum 1 homolog (S. cerevisiae) (RER1), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human RER1 retention in endoplasmic reticulum 1 homolog (S. cerevisiae) (RER1), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-RER1 antibody: synthetic peptide directed towards the middle region of human RER1. Synthetic peptide located within the following region: GIYHLNLFIAFLSPKVDPSLMEDSDDGPSLPTKQNEEFRPFIRRLPEFKF
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 23 kDa
Gene Name retention in endoplasmic reticulum sorting receptor 1
Background The protein encoded byThis gene is a multi-pass membrane protein that is localized toThe golgi apparatus. It is involved inThe retention of endoplasmic reticulum (ER) membrane proteins inThe ER and retrieval of ER membrane proteins fromThe early Golgi compartment to facilitate gamma-secretase complex assembly. [provided by RefSeq, Oct 2009]
Synonyms RP4-740C4.2
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%
Reference Data
Protein Families Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...