BTN2A1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-BTN2A1 antibody: synthetic peptide directed towards the N terminal of human BTN2A1. Synthetic peptide located within the following region: SVALVIHNITAQENGTYRCYFQEGRSYDEAILHLVVAGLGSKPLISMRGH
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	57 kDa
Gene Name	butyrophilin subfamily 2 member A1
Database Link	NP_008980 Entrez Gene 11120 Human UniProt ID Q7KYR7
Background	This gene encodes a member ofThe immunoglobulin superfamily.The gene is located in a cluster of butyrophilin-like genes inThe juxta-telomeric region ofThe major histocompatibility complex on chromosome 6. A pseudogene ofThis gene has been identified inThis cluster.The encoded protein is an integral plasma membrane protein involved in lipid, fatty-acid, and sterol metabolism. Alterations inThis gene may be associated with several disease states including metabolic syndrome. Multiple alternatively spliced transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Jul 2013]
Synonyms	BK14H9.1; BT2.1; BTF1; BTN2.1; DJ3E1.1
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Rabbit: 100%; Bovine: 93%; Rat: 91%; Mouse: 91%; Dog: 86%; Guinea pig: 86%; Horse: 82%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.