UGT1A4 Rabbit Polyclonal Antibody
CAT#: TA341883
Rabbit Polyclonal Anti-UGT1A4 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 4840.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-UGT1A4 antibody: synthetic peptide directed towards the N terminal of human UGT1A4. Synthetic peptide located within the following region: VVLTPEVNMHIKEEKFFTLTAYAVPWTQKEFDRVTLGYTQGFFETEHLLK |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 57 kDa |
Gene Name | UDP glucuronosyltransferase family 1 member A4 |
Database Link | |
Background | This gene encodes a UDP-glucuronosyltransferase, an enzyme ofThe glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites.This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases.The locus includes thirteen unique alternate first exons followed by four common exons. Four ofThe alternate first exons are considered pseudogenes. Each ofThe remaining nine 5' exons may be spliced toThe four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodesThe substrate binding site, and is regulated by its own promoter.This enzyme has some glucuronidase activity towards bilirubin, although is is more active on amines, steroids, and sapogenins. [provided by RefSeq, Jul 2008] |
Synonyms | HUG-BR2; UDPGT; UDPGT 1-4; UGT-1D; UGT1-04; UGT1.4; UGT1A4S; UGT1D |
Note | Immunogen Sequence Homology: Human: 100% |
Reference Data | |
Protein Families | Transmembrane |
Protein Pathways | Androgen and estrogen metabolism, Ascorbate and aldarate metabolism, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Metabolic pathways, Metabolism of xenobiotics by cytochrome P450, Pentose and glucuronate interconversions, Porphyrin and chlorophyll metabolism, Retinol metabolism, Starch and sucrose metabolism |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |