GALNT6 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GALNT6 antibody: synthetic peptide directed towards the middle region of human GALNT6. Synthetic peptide located within the following region: EIIPCSVVGHVFRTKSPHTFPKGTSVIARNQVRLAEVWMDSYKKIFYRRN
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	71 kDa
Gene Name	polypeptide N-acetylgalactosaminyltransferase 6
Database Link	NP_009141 Entrez Gene 11226 Human UniProt ID Q8NCL4
Background	This gene encodes a member ofThe UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAc-T) family of enzymes. GalNAc-Ts initiate mucin-type O-linked glycosylation inThe Golgi apparatus by catalyzingThe transfer of GalNAc to serine and threonine residues on target proteins.They are characterized by an N-terminal transmembrane domain, a stem region, a lumenal catalytic domain containing a GT1 motif and Gal/GalNAc transferase motif, and a C-terminal ricin/lectin-like domain. GalNAc-Ts have different, but overlapping, substrate specificities and patterns of expression.The encoded protein is capable of glycosylating fibronectin peptide in vitro and is expressed in a fibroblast cell line, indicating that it may be involved inThe synthesis of oncofetal fibronectin. [provided by RefSeq, Jul 2008]
Synonyms	GALNAC-T6; GalNAcT6
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Rabbit: 93%; Zebrafish: 93%; Bovine: 86%
Reference Data
Protein Families	Transmembrane
Protein Pathways	Metabolic pathways, O-Glycan biosynthesis

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.