ATP1B4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ATP1B4 antibody: synthetic peptide directed towards the middle region of human ATP1B4. Synthetic peptide located within the following region: ACQFKRSFLKNCSGLEDPTFGYSTGQPCILLKMNRIVGFRPELGDPVKVS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	41 kDa
Gene Name	ATPase Na+/K+ transporting family member beta 4
Database Link	NP_036201 Entrez Gene 23439 Human UniProt ID Q9UN42
Background	This gene has been found in all vertebrate genomes sequenced to date. However,This gene has undergone a change in function in placental mammals compared to other species. Specifically, in fish, avian, and amphibian species,This gene encodes plasma membrane-bound beta-subunits of Na,K-ATPase. In placental mammals,The encoded protein interacts withThe nuclear transcriptional coregulator SKIP and may be involved inThe regulation of TGF-beta signaling. Two transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Mar 2010]
Synonyms	(Na+); ATPase; beta 4 polypeptide; K+ transporting; K-ATPase beta-m subunit; OTTHUMP00000023940; X
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Families	Transmembrane
Protein Pathways	Cardiac muscle contraction

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.