BACE1 Rabbit Polyclonal Antibody

CAT#: TA341891

Rabbit Polyclonal Anti-Bace1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (4)
Transient overexpression lysate of beta-site APP-cleaving enzyme 1 (BACE1), transcript variant a
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human beta-site APP-cleaving enzyme 1 (BACE1), transcript variant a, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human beta-site APP-cleaving enzyme 1 (BACE1), transcript variant a, 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Mouse
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-Bace1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: YTPIRREWYYEVIIVRVEINGQDLKMDCKEYNYDKSIVDSGTTNLRLPKK
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 56 kDa
Gene Name beta-secretase 1
Background Responsible forThe proteolytic processing ofThe amyloid precursor protein (APP). Cleaves atThe N-terminus ofThe A-beta peptide sequence, between residues 671 and 672 of APP, leads toThe generation and extracellular release of beta-cleaved soluble APP, and a corresponding cell-associated C-terminal fragment which is later released by gamma-secretase.
Synonyms ASP2; BACE; HSPC104
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Protein Families Druggable Genome, Protease, Transmembrane
Protein Pathways Alzheimer's disease
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...