TIM 1 (HAVCR1) Rabbit Polyclonal Antibody
CAT#: TA341901
Rabbit Polyclonal Anti-HAVCR1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-HAVCR1 antibody: synthetic peptide directed towards the N terminal of human HAVCR1. Synthetic peptide located within the following region: CHYSGAVTSMCWNRGSCSLFTCQNGIVWTNGTHVTYRKDTRYKLLGDLSR |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 39 kDa |
Gene Name | hepatitis A virus cellular receptor 1 |
Database Link | |
Background | The protein encoded byThis gene is a membrane receptor for both human hepatitis A virus (HHAV) and TIMD4.The encoded protein may be involved inThe moderation of asthma and allergic diseases.The reference genome represents an allele that retains a MTTVP amino acid segment that confers protection against atopy in HHAV seropositive individuals. Three transcript variants encodingThe same protein have been found forThis gene. [provided by RefSeq, Mar 2010] |
Synonyms | HAVCR; HAVCR-1; KIM-1; KIM1; TIM; TIM-1; TIM1; TIMD-1; TIMD1 |
Note | Immunogen Sequence Homology: Human: 100% |
Reference Data | |
Protein Families | Druggable Genome, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |