TSPAN12 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TSPAN12 antibody: synthetic peptide directed towards the middle region of human TSPAN12. Synthetic peptide located within the following region: DSCCVREFPGCSKQAHQEDLSDLYQEGCGKKMYSFLRGTKQLQVLRFLGI
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	35 kDa
Gene Name	tetraspanin 12
Database Link	NP_036470 Entrez Gene 23554 Human UniProt ID O95859
Background	The protein encoded byThis gene is a member ofThe transmembrane 4 superfamily, also known asThe tetraspanin family. Most ofThese members are cell-surface proteins that are characterized byThe presence of four hydrophobic domains.The proteins mediate signal transduction events that play a role inThe regulation of cell development, activation, growth and motility. [provided by RefSeq, Jul 2008]
Synonyms	EVR5; NET-2; NET2; TM4SF12
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 85%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.