NNT Rabbit Polyclonal Antibody
CNY 5250.00
CNY 4840.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-NNT antibody: synthetic peptide directed towards the N terminal of human NNT. Synthetic peptide located within the following region: IVRGFDTRAAALEQFKSLGAEPLEVDLKESGEGQGGYAKEMSKEFIEAEM |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 114 kDa |
Gene Name | nicotinamide nucleotide transhydrogenase |
Database Link | |
Background | This gene encodes an integral protein ofThe inner mitochondrial membrane.The enzyme couples hydride transfer between NAD(H) and NADP(+) to proton translocation acrossThe inner mitochondrial membrane. Under most physiological conditions,The enzyme uses energy fromThe mitochondrial proton gradient to produce high concentrations of NADPH.The resulting NADPH is used for biosynthesis and in free radical detoxification. Two alternatively spliced variants, encodingThe same protein, have been found forThis gene. [provided by RefSeq, Jul 2008] |
Synonyms | GCCD4 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93% |
Reference Data | |
Protein Families | Transmembrane |
Protein Pathways | Metabolic pathways, Nicotinate and nicotinamide metabolism |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |