Siglec 7 (SIGLEC7) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SIGLEC7 antibody: synthetic peptide directed towards the middle region of human SIGLEC7. Synthetic peptide located within the following region: WRSLTLYPSQPSNPLVLELQVHLGDEGEFTCRAQNSLGSQHVSLNLSLQQ
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	51 kDa
Gene Name	sialic acid binding Ig like lectin 7
Database Link	NP_055200 Entrez Gene 27036 Human UniProt ID Q9Y286
Background	SIGLEC7 is a putative adhesion molecule that mediates sialic-acid dependent binding to cells. InThe immune response, it may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) viaTheir SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules. SIGLEC7 mediates inhibition of natural killer cells cytotoxicity. It may also play a role in hemopoiesis. SIGLEC7 inhibits differentiation of CD34+ cell precursors towards myelomonocytic cell lineage and proliferation of leukemic myeloid cells (in vitro).
Synonyms	AIRM1; CD328; CDw328; D-siglec; p75; QA79; SIGLEC-7; SIGLEC19P; SIGLECP2
Note	Immunogen Sequence Homology: Dog: 100%; Human: 100%; Horse: 92%; Pig: 86%; Guinea pig: 86%; Bovine: 85%
Reference Data
Protein Families	Druggable Genome, ES Cell Differentiation/IPS, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.