Torsin B (TOR1B) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TOR1B antibody: synthetic peptide directed towards the C terminal of human TOR1B. Synthetic peptide located within the following region: VFNNKHSGLWHSGLIDKNLIDYFIPFLPLEYRHVKMCVRAEMRARGSAID
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	38 kDa
Gene Name	torsin family 1 member B
Database Link	NP_055321 Entrez Gene 27348 Human UniProt ID O14657
Background	TOR1B may serve as a molecular chaperone assisting inThe proper folding of secreted and/or membrane proteins.
Synonyms	DQ1
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Bovine: 93%; Pig: 86%; Horse: 86%; Guinea pig: 86%; Rabbit: 85%; Zebrafish: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.