DULLARD (CTDNEP1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-DULLARD antibody: synthetic peptide directed towards the middle region of human DULLARD. Synthetic peptide located within the following region: HPDNAIPIKSWFSDPSDTALLNLLPMLDALRFTADVRSVLSRNLHQHRLW
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	28 kDa
Gene Name	CTD nuclear envelope phosphatase 1
Database Link	NP_056158 Entrez Gene 23399 Human UniProt ID O95476
Background	DULLARD is a serine/threonine phosphatase which may be required for proper nuclear membrane morphology. DULLARD was involved in LPIN1 dephosphorylation. It may antagonize BMP signaling.
Synonyms	DULLARD; HSA011916; NET56
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.