SUN2 Rabbit Polyclonal Antibody

CAT#: TA341972

Rabbit Polyclonal Anti-UNC84B Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5200.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (4)
Transient overexpression lysate of Sad1 and UNC84 domain containing 2 (SUN2)
    • 100 ug

CNY 4840.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human unc-84 homolog B (C. elegans) (UNC84B), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human unc-84 homolog B (C. elegans) (UNC84B), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-UNC84B antibody: synthetic peptide directed towards the N terminal of human UNC84B. Synthetic peptide located within the following region: SRRPDEGWEARDSSPHFQAEQRVMSRVHSLERRLEALAAEFSSNWQKEAM
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 80 kDa
Gene Name Sad1 and UNC84 domain containing 2
Background SUN1 (MIM 607723) and SUN2 are inner nuclear membrane (INM) proteins that play a major role in nuclear-cytoplasmic connection by formation of a 'bridge' acrossThe nuclear envelope, known asThe LINC complex, via interaction withThe conserved luminal KASH domain of nesprins (e.g., SYNE1; MIM 608441) located inThe outer nuclear membrane (ONM).The LINC complex provides a direct connection betweenThe nuclear lamina andThe cytoskeleton, which contributes to nuclear positioning and cellular rigidity (summary by Haque et al., 2010 [PubMed 19933576]). [supplied by OMIM, Nov 2010]. Transcript Variant:This variant (1) representsThe longest transcript and encodesThe longer isoform (a). Publication Note:This RefSeq record includes a subset ofThe publications that are available forThis gene. Please seeThe Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC094797.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025087, ERS025093 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete onThe 3' end.
Synonyms UNC84B
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Dog: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 86%
Reference Data
Protein Families Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...