Calcyon (CALY) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Caly antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: RHRSILAAIGAYPLSRKHGTEMPAIWGNSYRAGKEEHKGTTPAAMTVSTA
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	25 kDa
Gene Name	calcyon neuron specific vesicular protein
Database Link	NP_056537 Entrez Gene 50632 Human UniProt ID Q9NYX4
Background	dopamine receptor 1 (D1R) of D1-like receptors interacting protein [RGD, Feb 2006]. Transcript Variant:This variant (1) representsThe longer variant. Both variants 1 and 2 encodeThe same protein. ##Evidence-Data-START## Transcript exon combination :: AF303658.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS160522, ERS160537 [ECO:0000350] ##Evidence-Data-END##
Synonyms	DRD1IP; NSG3
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 86%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.