ARMCX3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ARMCX3 antibody: synthetic peptide directed towards the middle region of human ARMCX3. Synthetic peptide located within the following region: LFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKE
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	42 kDa
Gene Name	armadillo repeat containing, X-linked 3
Database Link	NP_057691 Entrez Gene 51566 Human UniProt ID Q9UH62
Background	This gene encodes a member ofThe ALEX family of proteins which may play a role in tumor suppression.The encoded protein contains a potential N-terminal transmembrane domain and a single Armadillo (arm) repeat. Other proteins containingThe arm repeat are involved in development, maintenance of tissue integrity, and tumorigenesis.This gene is closely localized with other family members onThe X chromosome. Three transcript variants encodingThe same protein have been identified forThis gene. [provided by RefSeq, Jul 2008]
Synonyms	ALEX3; dJ545K15.2; GASP6
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.