ARMCX3 Rabbit Polyclonal Antibody
CAT#: TA342021
Rabbit Polyclonal Anti-ARMCX3 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 3080.00
CNY 3080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ARMCX3 antibody: synthetic peptide directed towards the middle region of human ARMCX3. Synthetic peptide located within the following region: LFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKE |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 42 kDa |
Gene Name | armadillo repeat containing, X-linked 3 |
Database Link | |
Background | This gene encodes a member ofThe ALEX family of proteins which may play a role in tumor suppression.The encoded protein contains a potential N-terminal transmembrane domain and a single Armadillo (arm) repeat. Other proteins containingThe arm repeat are involved in development, maintenance of tissue integrity, and tumorigenesis.This gene is closely localized with other family members onThe X chromosome. Three transcript variants encodingThe same protein have been identified forThis gene. [provided by RefSeq, Jul 2008] |
Synonyms | ALEX3; dJ545K15.2; GASP6 |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |