ARMCX3 Rabbit Polyclonal Antibody
CAT#: TA342021
Rabbit Polyclonal Anti-ARMCX3 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 3080.00
CNY 3080.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-ARMCX3 antibody: synthetic peptide directed towards the middle region of human ARMCX3. Synthetic peptide located within the following region: LFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKE |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Concentration | lot specific |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 42 kDa |
| Gene Name | armadillo repeat containing, X-linked 3 |
| Database Link | |
| Background | This gene encodes a member ofThe ALEX family of proteins which may play a role in tumor suppression.The encoded protein contains a potential N-terminal transmembrane domain and a single Armadillo (arm) repeat. Other proteins containingThe arm repeat are involved in development, maintenance of tissue integrity, and tumorigenesis.This gene is closely localized with other family members onThe X chromosome. Three transcript variants encodingThe same protein have been identified forThis gene. [provided by RefSeq, Jul 2008] |
| Synonyms | ALEX3; dJ545K15.2; GASP6 |
| Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93% |
| Reference Data | |
| Protein Families | Transmembrane |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
