ADA2 Rabbit Polyclonal Antibody

CAT#: TA342028

Rabbit Polyclonal Anti-CECR1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human cat eye syndrome chromosome region, candidate 1 (CECR1), transcript variant 1, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Transient overexpression lysate of cat eye syndrome chromosome region, candidate 1 (CECR1), transcript variant 2
    • 100 ug

CNY 3080.00


Recombinant protein of human cat eye syndrome chromosome region, candidate 1 (CECR1), transcript variant 1, 100 µg
    • 100 ug

CNY 9998.00


Transient overexpression lysate of cat eye syndrome chromosome region, candidate 1 (CECR1), transcript variant 1
    • 100 ug

CNY 3080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-CECR1 antibody: synthetic peptide directed towards the N terminal of human CECR1. Synthetic peptide located within the following region: MQFRFAHPTPRPSEKCSKWILLEDYRKRVQNVTEFDDSLLRNFTLVTQHP
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 56 kDa
Gene Name cat eye syndrome chromosome region, candidate 1
Background This gene encodes a member of a subfamily ofThe adenosine deaminase protein family.The encoded protein is one of two adenosine deaminases found in humans, which regulate levels ofThe signaling molecule, adenosine.The encoded protein is secreted from monocytes undergoing differentiation and may regulate cell proliferation and differentiation.This gene may be responsible for some ofThe phenotypic features associated with cat eye syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]
Synonyms ADA2; ADGF; IDGFL
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families Druggable Genome, Secreted Protein, Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...