QPCTL Rabbit Polyclonal Antibody
CAT#: TA342033
Rabbit Polyclonal Anti-QPCTL Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-QPCTL antibody: synthetic peptide directed towards the middle region of human QPCTL. Synthetic peptide located within the following region: QLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFML |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | lot specific |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 43 kDa |
| Gene Name | glutaminyl-peptide cyclotransferase-like |
| Database Link | |
| Background | QPCTL is a single-pass membrane proteinPotential. It belongs toThe glutaminyl-peptide cyclotransferase family.The exact function of QPCTL remains unknown. |
| Synonyms | gQC |
| Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Rabbit: 93%; Pig: 92%; Guinea pig: 92%; Horse: 86% |
| Reference Data | |
| Protein Families | Protease, Transmembrane |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
