PIGV Rabbit Polyclonal Antibody

CAT#: TA342041

Rabbit Polyclonal Anti-PIGV Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (2)
Transient overexpression lysate of phosphatidylinositol glycan anchor biosynthesis, class V (PIGV)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution WB, IHC
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-PIGV antibody: synthetic peptide directed towards the N terminal of human PIGV. Synthetic peptide located within the following region: FVDQLVEGLLGGLSHWDAEHFLFIAEHGYLYEHNFAFFPGFPLALLVGTE
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 56 kDa
Gene Name phosphatidylinositol glycan anchor biosynthesis class V
Background This gene encodes a mannosyltransferase enzyme involved inThe biosynthesis of glycosylphosphatidylinositol (GPI). GPI is a complex glycolipid that functions as a membrane anchor for many proteins and plays a role in multiple cellular processes including protein sorting and signal transduction.The encoded protein is localized toThe endoplasmic reticulum and transfersThe second mannose toThe GPI backbone. Mutations inThis gene are associated with hyperphosphatasia mental retardation syndrome. Alternatively spliced transcript variants have been observed forThis gene. [provided by RefSeq, Feb 2011]
Synonyms GPI-MT-II; HPMRS1; PIG-V
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%
Reference Data
Protein Families Transmembrane
Protein Pathways Glycosylphosphatidylinositol(GPI)-anchor biosynthesis, Metabolic pathways
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...