TMEM132B Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TMEM132B antibody: synthetic peptide directed towards the middle region of human TMEM132B. Synthetic peptide located within the following region: VQEWFHRGTPVGQEESTNKSTTPQSPMEGKNKLLKSGGPDAFTSFPTQGK
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	119 kDa
Gene Name	transmembrane protein 132B
Database Link	NP_443139 Entrez Gene 114795 Human UniProt ID Q14DG7
Background	TMEM132B single-pass type I membrane protein. It belongs toThe TMEM132 family.The exact function of TMEM132B is not known.
Synonyms	KIAA1786; KIAA1906
Note	Immunogen Sequence Homology: Human: 100%; Horse: 93%; Dog: 86%; Bovine: 86%; Mouse: 79%; Pig: 77%; Guinea pig: 77%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.