GALNTL2 (GALNT15) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-GALNT15 antibody is: synthetic peptide directed towards the N-terminal region of Human GALNT15. Synthetic peptide located within the following region: LMLGCVLMMVAMLHPPHHTLHQTVTAQASKHSPEARYRLDFGESQDWVLE
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	67 kDa
Gene Name	polypeptide N-acetylgalactosaminyltransferase 15
Database Link	NP_473451 Entrez Gene 117248 Human UniProt ID Q8N3T1
Background	The function ofThis protein remains unknown.
Synonyms	GALNACT15; GALNT7; GALNT13; GALNTL2; PIH5; pp-GalNAc-T15
Note	Immunogen Sequence Homology: Human: 93%; Rat: 79%; Mouse: 79%
Reference Data
Protein Families	Transmembrane
Protein Pathways	Metabolic pathways, O-Glycan biosynthesis

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.