TMC2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TMC2 antibody: synthetic peptide directed towards the middle region of human TMC2. Synthetic peptide located within the following region: YCWCWDLEAGFPSYAEFDISGNVLGLIFNQGMIWMGSFYAPGLVGINVLR
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	102 kDa
Gene Name	transmembrane channel like 2
Database Link	NP_542789 Entrez Gene 117532 Human UniProt ID Q8TDI7
Background	TMC2 is considered a member of transmembrane proteins family.The specific function ofThis gene is unknown; however, expression inThe inner ear suggests that it may be crucial for normal auditory function.This gene is considered a member of a gene family predicted to encode transmembrane proteins.The specific function ofThis gene is unknown; however, expression inThe inner ear suggests that it may be crucial for normal auditory function. Mutations inThis gene may underlie hereditary disorders of balance and hearing. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-382 AF417580.2 1-382 383-569 DA769512.1 96-282 570-859 DA769512.1 286-575 860-2736 AF417580.2 860-2736 2737-3169 AL049712.12 30165-30597 c
Synonyms	C20orf145
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%; Rabbit: 85%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.