Diffuse panbronchiolitis critical region protein 1 (DPCR1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-DPCR1 antibody: synthetic peptide directed towards the C terminal of human DPCR1. Synthetic peptide located within the following region: SHLNKTEVTHQVPTGSFTLITSRTKLSSITSEATGNESHPYLNKDGSQKG
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	55 kDa
Gene Name	diffuse panbronchiolitis critical region 1
Database Link	NP_543146 Entrez Gene 135656 Human UniProt ID Q3MIW9
Background	The exact function of DPCR1 remains unknown.
Synonyms	PBLT
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.