TCEAL4 Rabbit Polyclonal Antibody
CAT#: TA342116
Rabbit Polyclonal Anti-TCEAL4 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 3080.00
CNY 3080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-TCEAL4 antibody: synthetic peptide directed towards the middle region of human TCEAL4. Synthetic peptide located within the following region: GSETRAAGKRPAEDDVPRKAKRKTNKGLAHYLKEYKEAIHDMNFSNEDMI |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 25 kDa |
Gene Name | transcription elongation factor A like 4 |
Database Link | |
Background | TCEAL4 is a member ofThe transcription elongation factor A (SII)-like (TCEAL) gene family. Members ofThis family contain TFA domains and may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. Multiple family members are located onThe X chromosome.This gene encodes a member ofThe transcription elongation factor A (SII)-like (TCEAL) gene family. Members ofThis family contain TFA domains and may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. Multiple family members are located onThe X chromosome. Alternative splicing occurs forThis gene; however,The full-length nature of all transcript variants has not yet been described. |
Synonyms | NPD017; WEX7 |
Note | Immunogen Sequence Homology: Horse: 100%; Human: 100%; Rabbit: 100%; Pig: 92%; Bovine: 92%; Rat: 90%; Dog: 85%; Mouse: 85%; Guinea pig: 85% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |