ZNF648 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF648 antibody: synthetic peptide directed towards the N terminal of human ZNF648. Synthetic peptide located within the following region: MAQVDSQDRWGEASPLSSLTEEAHDTQMLSMNLESDDEDGGEAEKEGTAD
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	62 kDa
Gene Name	zinc finger protein 648
Database Link	NP_001009992 Entrez Gene 127665 Human UniProt ID Q5T619
Background	ZNF648 may be involved in transcriptional regulation.
Synonyms	OTTHUMP00000035419; zinc finger protein 648
Note	Immunogen Sequence Homology: Human: 100%; Rat: 85%; Mouse: 79%; Pig: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.