ZNF780A Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF780A antibody: synthetic peptide directed towards the N terminal of human ZNF780A. Synthetic peptide located within the following region: TSRRYPDLELKYGPEKVSPENDTSEVNLPKQVIKQISTTLGIEAFYFRND
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	70 kDa
Gene Name	zinc finger protein 780A
Database Link	NP_001010880 Entrez Gene 284323 Human UniProt ID O75290
Background	ZNF780A belongs to the krueppel C2H2-type zinc-finger protein family. It contains 17 C2H2-type zinc fingers and 1 KRAB domain. ZNF780A may be involved in transcriptional regulation.
Synonyms	ZNF780
Note	Immunogen Sequence Homology: Horse: 100%; Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.