Proteasome beta 1 (PSMB1) Rabbit Polyclonal Antibody
CAT#: TA342163
Rabbit polyclonal Anti-PSMB1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-PSMB1 antibody: synthetic peptide directed towards the middle region of human PSMB1. Synthetic peptide located within the following region: NNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVG |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | lot specific |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 26 kDa |
| Gene Name | proteasome subunit beta 1 |
| Database Link | |
| Background | The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure.The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome,The immunoproteasome, isThe processing of class I MHC peptides.This gene encodes a member ofThe proteasome B-type family, also known asThe T1B family, that is a 20S core beta subunit.This gene is tightly linked toThe TBP (TATA-binding protein) gene in human and in mouse, and is transcribed inThe opposite orientation in both species. [provided by RefSeq, Jul 2008] |
| Synonyms | HC5; PMSB1; PSC5 |
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Yeast: 93%; Zebrafish: 93% |
| Reference Data | |
| Protein Families | Protease |
| Protein Pathways | Proteasome |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
其它Proteasome beta 1产品
