S4 (PSMC1) Rabbit Polyclonal Antibody
CAT#: TA342172
Rabbit polyclonal Anti-Psmc1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Mouse |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-Psmc1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDG |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Concentration | lot specific |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 48 kDa |
| Gene Name | proteasome 26S subunit, ATPase 1 |
| Database Link | |
| Background | The 26S protease is involved inThe ATP-dependent degradation of ubiquitinated proteins.The regulatory (or ATPase) complex confers ATP dependency and substrate specificity toThe 26S complex. |
| Synonyms | P26S4; p56; S4 |
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100% |
| Reference Data | |
| Protein Pathways | Proteasome |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |

