RALB Rabbit Polyclonal Antibody
CNY 4628.00
CNY 3080.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-RALB antibody: synthetic peptide directed towards the middle region of human RALB. Synthetic peptide located within the following region: FREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVE |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 23 kDa |
Gene Name | RALB Ras like proto-oncogene B |
Database Link | |
Background | This gene encodes a GTP-binding protein that belongs toThe small GTPase superfamily and Ras family of proteins. GTP-binding proteins mediateThe transmembrane signaling initiated byThe occupancy of certain cell surface receptors. [provided by RefSeq, Jul 2008] |
Synonyms | GTP binding protein; GTP binding protein); RAS-like protein B; v-ral simian leukemia viral oncogene homolog B; v-ral simian leukemia viral oncogene homolog B (ras related |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Goat: 86%; Yeast: 79% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Pancreatic cancer, Pathways in cancer |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |