RAP1GAP Rabbit Polyclonal Antibody

CAT#: TA342187

Rabbit polyclonal Anti-RAP1GAP Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human RAP1 GTPase activating protein (RAP1GAP), transcript variant 3, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Transient overexpression lysate of RAP1 GTPase activating protein (RAP1GAP), transcript variant 2
    • 100 ug

CNY 4840.00


Recombinant protein of human RAP1 GTPase activating protein (RAP1GAP), transcript variant 3, 100 µg
    • 100 ug

CNY 9998.00


Transient overexpression lysate of RAP1 GTPase activating protein (RAP1GAP), transcript variant 3
    • 100 ug

CNY 3080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-RAP1GAP antibody: synthetic peptide directed towards the middle region of human RAP1GAP. Synthetic peptide located within the following region: IENIQEVQEKRESPPAGQKTPDSGHVSQEPKSENSSTQSSPEMPTTKNRA
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 73 kDa
Gene Name RAP1 GTPase activating protein
Background This gene encodes a type of GTPase-activating-protein (GAP) that down-regulatesThe activity ofThe ras-related RAP1 protein. RAP1 acts as a molecular switch by cycling between an inactive GDP-bound form and an active GTP-bound form.The product ofThis gene, RAP1GAP, promotesThe hydrolysis of bound GTP and hence returns RAP1 toThe inactive state whereas other proteins, guanine nucleotide exchange factors (GEFs), act as RAP1 activators by facilitatingThe conversion of RAP1 fromThe GDP- toThe GTP-bound form. In general, ras subfamily proteins, such as RAP1, play key roles in receptor-linked signaling pathways that control cell growth and differentiation. RAP1 plays a role in diverse processes such as cell proliferation, adhesion, differentiation, and embryogenesis. Alternative splicing results in multiple transcript variants encoding distinct proteins. [provided by RefSeq, Aug 2011]
Synonyms RAP1GA1; RAP1GAP1; RAP1GAPII; RAPGAP
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 86%; Zebrafish: 86%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...