RAP1GAP Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RAP1GAP antibody: synthetic peptide directed towards the middle region of human RAP1GAP. Synthetic peptide located within the following region: IENIQEVQEKRESPPAGQKTPDSGHVSQEPKSENSSTQSSPEMPTTKNRA
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	73 kDa
Gene Name	RAP1 GTPase activating protein
Database Link	NP_002876 Entrez Gene 5909 Human UniProt ID P47736
Background	This gene encodes a type of GTPase-activating-protein (GAP) that down-regulatesThe activity ofThe ras-related RAP1 protein. RAP1 acts as a molecular switch by cycling between an inactive GDP-bound form and an active GTP-bound form.The product ofThis gene, RAP1GAP, promotesThe hydrolysis of bound GTP and hence returns RAP1 toThe inactive state whereas other proteins, guanine nucleotide exchange factors (GEFs), act as RAP1 activators by facilitatingThe conversion of RAP1 fromThe GDP- toThe GTP-bound form. In general, ras subfamily proteins, such as RAP1, play key roles in receptor-linked signaling pathways that control cell growth and differentiation. RAP1 plays a role in diverse processes such as cell proliferation, adhesion, differentiation, and embryogenesis. Alternative splicing results in multiple transcript variants encoding distinct proteins. [provided by RefSeq, Aug 2011]
Synonyms	RAP1GA1; RAP1GAP1; RAP1GAPII; RAPGAP
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 86%; Zebrafish: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.