RASGRF1 Rabbit Polyclonal Antibody
CAT#: TA342190
Rabbit polyclonal Anti-RASGRF1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 2900.00
CNY 6650.00
CNY 4840.00
CNY 4840.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-RASGRF1 antibody: synthetic peptide directed towards the N terminal of human RASGRF1. Synthetic peptide located within the following region: RELDNNRSALSAASAFAIATAGANEGTPNKEKYRRMSLASAGFPPDQRNG |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 54 kDa |
Gene Name | Ras protein specific guanine nucleotide releasing factor 1 |
Database Link | |
Background | The protein encoded byThis gene is a guanine nucleotide exchange factor (GEF) similar toThe Saccharomyces cerevisiae CDC25 gene product. Functional analysis has demonstrated thatThis protein stimulatesThe dissociation of GDP from RAS protein.The studies ofThe similar gene in mouse suggested thatThe Ras-GEF activity ofThis protein in brain can be activated by Ca2+ influx, muscarinic receptors, and G protein beta-gamma subunit. Mouse studies also indicated thatThe Ras-GEF signaling pathway mediated byThis protein may be important for long-term memory. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Mar 2009] |
Synonyms | CDC25; CDC25L; GNRP; GRF1; GRF55; H-GRF55; PP13187; ras-GRF1 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Horse: 93%; Rabbit: 93%; Zebrafish: 93%; Mouse: 85% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Focal adhesion, MAPK signaling pathway |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |
其它RASGRF1产品