MYO1E Rabbit Polyclonal Antibody

CAT#: TA342227

Rabbit polyclonal Anti-MYO1E Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (2)
Transient overexpression lysate of myosin IE (MYO1E)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-MYO1E antibody: synthetic peptide directed towards the middle region of human MYO1E. Synthetic peptide located within the following region: PKPQPKPKPQVPQCKALYAYDAQDTDELSFNANDIIDIIKEDPSGWWTGR
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 127 kDa
Gene Name myosin IE
Background This gene encodes a member ofThe nonmuscle class I myosins which are a subgroup ofThe unconventional myosin protein family.The unconventional myosin proteins function as actin-based molecular motors. Class I myosins are characterized by a head (motor) domain, a regulatory domain and a either a short or long tail domain. AmongThe class I myosins,This protein is distinguished by a long tail domain that is involved in crosslinking actin filaments.This protein localizes toThe cytoplasm and may be involved in intracellular movement and membrane trafficking. Mutations inThis gene areThe cause of focal segmental glomerulosclerosis-6.This gene has been referred to as myosin IC inThe literature but is distinct fromThe myosin IC gene located on chromosome 17. [provided by RefSeq, Jan 2012]
Synonyms FSGS6; HuncM-IC; MYO1C
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...