Cdx1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Cdx1 antibody: synthetic peptide directed towards the c terminal of mouse Cdx1. Synthetic peptide located within the following region: QQQPLPPTQLPLPLDGTPTPSGPPLGSLCPTNAGLLGTPSPVPVKEEFLP
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	28 kDa
Gene Name	caudal type homeobox 1
Database Link	NP_034010 Entrez Gene 12590 Mouse UniProt ID P18111
Background	Could play a role in the terminal differentiation of the intestine.
Synonyms	MGC116915
Note	Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Rabbit: 86%; Pig: 79%; Horse: 79%; Bovine: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.