Taf1b Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TAF1B antibody: synthetic peptide directed towards the C terminal of mouse TAF1B. Synthetic peptide located within the following region: YQFILNIFSFLLRIKTSALHEEVSLLEKKLFEKKYNESKKSSGSKKGRRH
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	64 kDa
Gene Name	TATA-box binding protein associated factor, RNA polymerase I, B
Database Link	NP_065639 Entrez Gene 21340 Mouse UniProt ID P97358
Background	TAF1b belongs to the family of TATA box binding protein (Tbp)-associated factors. Promoter selectivity for all three classes of eukaryotic RNA polymerases is brought about by multimeric protein complexes containing TATA box binding protein (TBP) and specific TBP-associated factors (TAFs).
Synonyms	MGC:9349; RAF1B; RAFI63; SL1; TAFI63
Note	Immunogen Sequence Homology: Mouse: 100%; Rat: 92%; Pig: 82%; Guinea pig: 82%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.