C9orf152 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-C9orf152 antibody: synthetic peptide directed towards the N terminal of human C9orf152. Synthetic peptide located within the following region: MEGLPCPCPALPHFWQLRSHLMAEGSRTQAPGKGPPLSIQFLRAQYEGLK
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	24 kDa
Gene Name	chromosome 9 open reading frame 152
Database Link	NP_001013011 Entrez Gene 401546 Human UniProt ID Q5JTZ5
Background	The function of this protein remains unknown.
Synonyms	bA470J20.2
Note	Immunogen Sequence Homology: Human: 100%; Pig: 92%; Mouse: 92%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.