ZNF131 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF131 antibody: synthetic peptide directed towards the N terminal of human ZNF131. Synthetic peptide located within the following region: EFLQMLEAIKALEVRNKENSAPLEENTTGKNEAKKRKIAETSNVITESLP
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	67 kDa
Gene Name	zinc finger protein 131
Database Link	NP_003423 Entrez Gene 7690 Human UniProt ID P52739
Background	ZNF131 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 1 BTB (POZ) domain and 6 C2H2-type zinc fingers. It may be involved in transcriptional regulation. ZNF131 plays a role during development and organogenesis as well as in the function of the adult central nervous system.
Synonyms	pHZ-10; ZBTB35
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Bovine: 93%; Rabbit: 93%; Horse: 86%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.