SEPN1 (SELENON) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB, IHC
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Sepn1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VHHINANYFLDITSMKPEDMENNNVFSFSSSFEDPSTATYMQFLREGLRR
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	62 kDa
Gene Name	selenoprotein N, 1
Database Link	NP_996809 Entrez Gene 74777 Mouse UniProt ID Q9NZV5
Background	This gene encodes a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. The function of this gene in mouse is not known, however, mutations in the homologous gene in human are associated with multiminicore disease and rigid spine muscular dystrophy. [provided by RefSeq, Jul 2008]
Synonyms	CFTD; MDRS1; RSMD1; RSS; SELN
Note	Immunogen Sequence Homology: Human: 100%; Pig: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Guinea pig: 86%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.