UBXN6 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-UBXN6 antibody: synthetic peptide directed towards the C terminal of human UBXN6. Synthetic peptide located within the following region: YARERLGAVYGFVREALQSDWLPFELLASGGQKLSEDENLALNECGLVPS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	44 kDa
Gene Name	UBX domain protein 6
Database Link	NP_001164562 Entrez Gene 80700 Human UniProt ID Q9BZV1
Background	The function of UBXN6 remains unknown.
Synonyms	UBXD1; UBXDC2
Note	Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 93%; Rat: 86%; Mouse: 79%; Guinea pig: 79%; Dog
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.